PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G004700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 214aa    MW: 23015.1 Da    PI: 6.9801
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G004700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.7e-45191181100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++q
  Sobic.005G004700.1.p  19 PCASCKLLRRRCTQECVFAPYFPPEDPHKFAIVHKVFGASNVSKMLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQ 107
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+++lal+k+e
  Sobic.005G004700.1.p 108 LQVQLALAKAE 118
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.64418119IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4419116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MADSGNGSRS SSSSSSSPPC ASCKLLRRRC TQECVFAPYF PPEDPHKFAI VHKVFGASNV  60
SKMLQELPAQ QRADAVSSLV YEANARMRDP VYGCVGAISY LQQQVSQLQV QLALAKAEIL  120
CVQMHHDYES ASAAAAAAPA PAKQQQLQQQ QQEEMECEAY GNLLVQNGLM MNTLNGTGAV  180
HQQQKQMLGG FGSAGNTAMM LQEACLKKES LWA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008521e-121FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661028.11e-105PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW35e-67LBD12_ARATH; LOB domain-containing protein 12
TrEMBLC5Y2Z91e-104C5Y2Z9_SORBI; Putative uncharacterized protein Sb05g000550
STRINGSb05g000550.11e-104(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-57LBD family protein